PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00018769001
Common NameGSBRNA2T00018769001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 376aa    MW: 41363.7 Da    PI: 6.4084
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00018769001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.8e-28136190156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          kp+++WtpeLH++Fveave+L G +kA+P++ile+m+vk+L +++v+SHLQkYR++
  GSBRNA2T00018769001 136 KPKVDWTPELHRKFVEAVERL-GVDKAVPSRILEIMNVKSLNRHNVASHLQKYRSH 190
                          79*******************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.204133192IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-27134193IPR009057Homeodomain-like
SuperFamilySSF466891.16E-18134193IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-25136190IPR006447Myb domain, plants
PfamPF002494.1E-7139188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MLTVSPLVVN TTPRDHYMAA DFADFTAEGL PDFTAEEGSL DVLEGIDFYD DLFIEFNGDD  60
VLPDLEIDSD VLGEYSGSGR DEEQEMEGNT SAASETSERD GGWCKPEGTD KTVRKGKRKG  120
KKTKDCLSND NGIKKKPKVD WTPELHRKFV EAVERLGVDK AVPSRILEIM NVKSLNRHNV  180
ASHLQKYRSH RKHLLAREAE AASWNLRRHT TVAVPEGGEK LSMALPALGY PPHVTPLHQG  240
HFRPLHVWGH PTWPKHKPNN PSSSPLRTFP IPPAVAVAPS CWPGQLPYWH LQTLYPQGYG  300
MASSNHSSIG VPTRQLGPTN PPIDIHPSNE SIDAALGDVI TKPWLPLPLG LNPPSVDGVM  360
TELQRQGISN VPPLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-18134188357ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RKGKRKGKK
2116124KRKGKKTKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.169550.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00018769001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013707265.10.0PREDICTED: transcription activator GLK2-like
SwissprotQ9FFH00.0GLK2_ARATH; Transcription activator GLK2
TrEMBLA0A078GC870.0A0A078GC87_BRANA; BnaA06g36250D protein
STRINGBra033726.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.10.0GOLDEN2-like 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]